PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03147g02010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 580aa    MW: 65014.3 Da    PI: 8.8746
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03147g02010.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.52.3e-083984282454
                               S--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  24 ypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               yp+ +++  LAk++gL+ +qV++WF N R +
  Niben101Scf03147g02010.1 398 YPTDTDKVMLAKQTGLSRNQVSNWFINARVR 428
                               9****************************88 PP

2BELL81.41.2e-261672201972
                      BELL  19 VdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                               V +rYkqy++qlq+v+ sFe vaglg+a+p+++lAlk++S+hF cLk+ai++q+
  Niben101Scf03147g02010.1 167 VFQRYKQYHQQLQMVVTSFESVAGLGNAAPFANLALKTMSKHFNCLKNAITDQL 220
                               789************************************************997 PP

3BELL81.11.5e-262803331972
                      BELL  19 VdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                               V +rYkqy++qlq+v+ sFe vaglg+a+p+++lAlk++S+hF cLk+ai++q+
  Niben101Scf03147g02010.1 280 VFQRYKQYHQQLQMVVTSFESVAGLGNAAPFANLALKTMSKHFNCLKNAITDQL 333
                               789************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.4E-23121218IPR006563POX domain
PfamPF075267.6E-22167217IPR006563POX domain
SMARTSM005747.5E-8225331IPR006563POX domain
PfamPF075267.0E-22280330IPR006563POX domain
CDDcd000861.51E-9380433No hitNo description
SMARTSM003892.8E-6380436IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.2E-17393436IPR009057Homeodomain-like
SuperFamilySSF466891.45E-11396438IPR009057Homeodomain-like
PfamPF059202.5E-13397428IPR008422Homeobox KN domain
PROSITE profilePS5007110.932398432IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 580 aa     Download sequence    Send to blast
MAEGFEPYHV PQQSRRDKLR VLVDDNLQLQ NYAPYYDPSI IPSDLPTFQE INGTPFLYTP  60
QNLRFLDQSI RTSGEIMMHN SSNNNTNGQG LSLSLSCLHH NSTTNHDLLS KSSCVPLGPF  120
TGYSLILKRS RFLKPAQLLL EELCDVGREK LAADDFTLID PIHENIVFQR YKQYHQQLQM  180
VVTSFESVAG LGNAAPFANL ALKTMSKHFN CLKNAITDQL LFTNESRHGQ INSEKDLIPR  240
VGKGLYCHKP DKIHNNAGFA DRTQPVWRPQ RGLPERAVTV FQRYKQYHQQ LQMVVTSFES  300
VAGLGNAAPF ANLALKTMSK HFNCLKNAIT DQLLFTNESR HGQINSEKDL IPRVGKGLYC  360
HKPDKIHNNA GFADRTQPVW RPQRGLPERA VTVLRACYPT DTDKVMLAKQ TGLSRNQVSN  420
WFINARVRLW KPMVEEIHML ETKEAHNKDS QRDGQNSNNN SIEHFPTSNS HAACETPSAS  480
APRLQDTPSK RTRNNFPMGN ADSISLSYGN LSTGTGGVSL TLGLHQNTGI ALSEPFPINA  540
ARRFGIDANS DRFMVGGFEE QNGQFGRNIV GGQFLHDFAG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009606015.10.0PREDICTED: BEL1-like homeodomain protein 9
SwissprotQ9LZM82e-74BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLA0A0V0I3L21e-136A0A0V0I3L2_SOLCH; Putative BEL1-like homeodomain protein 9-like (Fragment)
STRINGSolyc09g011380.2.11e-134(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35202237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-68TALE family protein